NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0248169_101507

Scaffold Ga0248169_101507


Overview

Basic Information
Taxon OID3300022602 Open in IMG/M
Scaffold IDGa0248169_101507 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterU.S. Department of Energy (DOE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)32113
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (48.94%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Trout Bog Lake, Vilas County, Wisconsin, United States

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.0412Long. (o)-89.6861Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004256Metagenome446Y
F024484Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0248169_10150723F004256AGGMNYEYYYNNVPGEGLTRNNLIYTSLISKDKKTFVQWYHNDTEYHRGKNQVIDPAKMDEKWHREIHYLHNMAHHFPNLVPEILEVNVPERKIYLRIDGPDFWERSQCDQNNYITIVPDWQEQMLGIIKAHKSHGWHKYSMHPSSYFVVEGQLKSINYFFTYHEDEPTVSIKDVESHIHTNRQEQMRKHLELLGISWDDPQPWSIMDQLCWESFSTNYPAEFIERIKCLN
Ga0248169_10150740F024484N/AMLTPTNYTVDLKLFQEACNQLPKHGMKTTINRPTGDFFYDSWVLKDEYKDTVWEILYNSLPVIKGEARIIILDPGQCYQIHADIDDRYHLNILGDNSYLIDLVRDIMHPLAQDGIWYDMDASFLHTATNFGRKARVQLVVRKLLKKNKLQNPIEVSLATTMDNPNHARFLFDNTMSPWLNDANKAGFINNFSQGAVTIKFNIEQDKLINLKRILPEEFKIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.